GenomeNet

>mpr:MPER_11088 hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MVLRLYGSRLTTCSTRVEVVLIEKQIPYDFIEVNLVPSVSEQKTEAHKEKQPFGKVPYID
DDGFILYESRAICRYLEVAYAGFKTRLAPPTSDGRLPPPLVKLFDRPSLAF

BLAST