GenomeNet

>mpr:MPER_11995 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) hypothetical protein (A)
VLGELACEPLRVAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHMYDTVK
GSDWLGDQDAIHYMCREAPSTVIELEHFGVPFSRTKDGKIYQRAFGGQSLKYGKGGQAYR
CAAAADRTGHAILHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFR
AHKTVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFVQFHPTGIYGAGCLIT
EGSRGEGGYLLNSEGERFMERYAPTAKDLASRDAVSRSMTIEIPEGRGVGPKGDPLSHLQ
HAAWTGAFSPLTGKP

BLAST