GenomeNet

>mpr:MPER_12265 hypothetical protein; K01113 alkaline phosphatase D [EC:3.1.3.1] (A)
MFIWTGGVNFTHSVASVRNIGDPFNTSVLLWTRAVPVSPDGTNELPDQSIPACLSFKISS
NSDLSGAPLDTGEVFTSYDVDWTAKVEANGLTPDTKYFFQFSDCANPSIVSPIGATRTLP
SPDTPADEVNGGKGLTFAVFSCSQYQAGYFNAYGFAAHNTTADIFVHLGDYIYESLGNGS
LRARIGRQTLGRELATIHDYRQRLNQYRTDTSLAFAHQNAPWGELTNYLSIFHHRSTSRL
KDDHEVADNAWKAGTADSNDTAVGCSFSPSGACFTDRKLAAVRAYHEWMPIRQVAADDQF
RIWRNFQVGQLMDLTMLDTRQYDRDLTDVYYNSVVNTISSFPNRSLMGAAQESWLYDTLS
ESKERGAVWRVIGQQIVFTQLNESGGCLIYFLYQYQLTL

BLAST