GenomeNet

>mpr:MPER_16448 hypothetical protein; K00111 glycerol-3-phosphate dehydrogenase [EC:1.1.5.3] (A)
MYDLLAGKENMESSYLMSKGKALETFPMLKSDGLVGALVYYDGQHNDSRMNIALILTAVK
HGAVVANYTE

BLAST