GenomeNet

>mpu:MYPU_1450 MYPU_1450; THYMIDINE KINASE (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MYNRFNKGMIEVITGPMFSGKTEELLRRFRLLNYAKAKTLLIKPAFDTRFSKEEIISRAG
VKTKTHSVKNTEQIRKILEKEKFDALVIDEIHFFDFDIVYLIEELANSGYHIIVSGLDQN
FKREPFEVVSYLLSIAEKVTKLQAICVKCQRAATTTFRKVESKEIKLLGDVDEYEARCRK
CHIQGSKDKN

BLAST