GenomeNet

>mpy:Mpsy_0785 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) glycoside hydrolase family protein (A)
MKAICVCFEVHLPLPLRWYWPREGYGAPALEKYFEMEKTYGSFIRLNEGVRTLNSALMYS
METGGRYTFDISGVFLEQCKWEPAILESFRQLVDMGANLAASPYYHSVCPLFPDLEEFKE
QVSMHMKSLGGLFGVKPAAFINPELLLEQRTVAVCRDLGFRCFISEGSYNIVNGCDPVHV
YENDVPTLLRHIDLSEDVEKRLSDRKWPGYPLIAEKFASWIAGMEGDVITLYIRYDSLHI
HLQKNAEIVQFLKDLPGSLSVHGIEMVFPEEAAGMFRQAELPSLHSKMTARYGMHNLLGN
HAQHLYMHELQSIGEELDKLKMHEDYAKLRTIYRYLQQSDIFLEMNAESQRLGYEKAVNN
FSILSDMKRALTEAGK

BLAST