GenomeNet

>mrb:Mrub_0477 K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12] | (GenBank) catalytic domain of components of various dehydrogenase complexes (A)
MAELKLPDLGDNVTSAVVVGVLIKEGDTIAAGQPVLELETDKAVMEAPASEGGTVSKVLV
KPGDEVKSGQVIAVLGDAAPSAEKQEPKEKQEPKEEKAAPAPAPTPAPAATPSAPAAAPR
PPASAAPAGQRRLIPAAPSVRRLAREMGINLMEVVGSGPAYRISENDLKRFAAGEAPTTA
APQPSSAPALPDFSKFGPVRREAMSGVRRATVRSMAQAWSTIPMVTHFDRADITEMEALR
KRMAPRAEQRGAKVTMTAILLKIAAAALKQFPKFNASIDTASNEIIYKDYIHIGVAVDTP
TGLLVPVVRDVDKKGVIALAKELGEIAAKARERKLTPEEMQGATFTISNLGGIGGTGFTP
IVNWPEVAIMGVSRSSMEPVWSAEKGVFEPRNIMPFSLSYDHRLIDGADAARFCRFVAEL
LEDPFLLGFEG

BLAST