GenomeNet

>mrb:Mrub_1353 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) Thymidine kinase (A)
MPHLPHHQGWIEVVVGPMFSGKSDELIRRVKRALIARQRVLVFKPRLDDRYHASDVFSHD
GRRAEAIAVRDAAELRAHLSDPLPDVVAVDEAQFFDAGLVALVLELADRGVRVICAGLDM
DFRGEPFGIMPQLLARAEYVEKLFAVCPVCGAPATRTQRFVNGKPARYDDPVILVGASEA
YEPRCRKCHTVVTKEVQEIL

BLAST