GenomeNet

>mrd:Mrad2831_6132 K01921 D-alanine-D-alanine ligase [EC:6.3.2.4] | (GenBank) D-alanine-D-alanine ligase and related ATP-grasp protein-like protein (A)
MGRGDKAWTALRAVTDRILGVADDITVALVANSKGAVSSDPGDRSTEYLSDGEANQLLTG
LRSAGFRTRYFDGERAFIEQTLTDPTLGTHGPRLLVYNIAQSGTDAGRKSLVPAFCALQG
IATCNSNAYVVSLARNKLHVHSILKRFGLSVPDSWSYQAGSGWLLGRRPSGDATLIAKAI
HESASIGLDGDSIGRAGAEYETMLARKSRTLRQAMFVQRLVAGREMETPVVRVGGQVHVL
GPAIVTLGGTDHLGSRILDYDSVAHDDYGYAVPGPAEAPVVAKVRRVAAAAYETLGLEGF
ARVDFRVDDAGRPFVIDVATSPHLVWHSAYAHVFRAAGWGHEEMLACMVAVNARRLGWI

BLAST