GenomeNet

>msa:Mycsm_06080 no KO assigned | (GenBank) DNA polymerase LigD, polymerase domain protein (A)
MATPAEEIDVDGVKVRLTNPDKVYFPKLGSDGTKRKLVEYYLAVASGPMLTALRDRPTHL
QRFPDGIEGEEIYQKRIPKHAPDYLETCVVTFPSGRTADALKVTHAAAIVWAAQMGTITL
HPWQVRCADTEHPDELRVDLDPQPGTAFKEARAIAVDVLKPVLDELGLVGYPKTSGGRGV
HIFLRIKPDWDFIAVRRAGIALAREVQRRAPDAVTTSWWKEERGKRIFIDYNQNARDRTF
ASAYSARKTPIATVSMPLTWDELRDADPDNYTITTAPGFVAGRDDPWEGIDSVAQSLEPL
MEMVKADEERGLGDLPYPPSYPKMPGEPPRVQPSKKVAANWDDEGNPVSR

BLAST