GenomeNet

>msg:MSMEI_3019 K01595 phosphoenolpyruvate carboxylase [EC:4.1.1.31] | (GenBank) hypothetical protein (A)
MADSNDTALEPFGSVQRTHIGREASEPMREDIRLLGAILGDTVREQNGEEVFDLVERARV
ESFRVRRSEIDRSELADMFSGVDAHQAIPVIRAFTHFALLANVAEDIHRERRRAVHVAAG
KPPQDSSLAATYRKLDAADLDVDKVADTLTGALVSPVITAHPTETRRRTVFDTQHRITEL
MRLRLHGHTRTDDNRDIETELRRHILTLWQTALIRLSRLKISDEIETGLRYYEAAFFDVI
PQVNAEVRDALRKRWPDAKLLEEPILRPGSWIGGDRDGNPNVTPEVVRHATGRAAYVALA
HYFEQITALEQELSMSARLVKVTPALAALADACHEPARADEPYRRALRVIHARLTSTARE
ILDEQPEHGLDLGLPRYQTPAEFLADLDAVDGSLRANGSRVLADDRLGRLREAVRVFGFH
LSGLDMRQNSDVHEEVVAELLAWAGVHPDYTSLSEPQRVELLAAEIATRRPLIREGAELS
ELAQKELGIVAAAARAVKVFGPQAVPNYIISMCQSVSDMLEAAVLLKEAGLLDISGSTPY
APVGVVPLFETIDDLQRGSSILEAALDLPEYRTMVDARDGHQEVMLGYSDSNKDGGYLAA
NWALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVKGSLRITEQ
GEVIAAKYAEPRIAHRNLETLLAATLEASLLDVEGLGEEAEPAYQVLDELAALAQRAYSE
LVHETPGFVEYFKTSTPVSEIGALNIGSRPTSRKPTTSIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFENWIGTDPDGARLRVLQDLYARWPFFRTVLSNMAQVLAKADMGLAARYSELV
EDADLRARVFDKIVAEHDRTIRMHRLITGQDDLLADNAALARSVFNRFPYLEPLNHLQVE
LLRRYRSGETDELVQRGILLTMSGLATALRNSG

BLAST