GenomeNet

>msg:MSMEI_6136 no KO assigned | (GenBank) DNA primase small subunit (A)
MASAATELDVDGVKVRFTNPDKVYFPKLGKNGTKGKLVEYYLSVASGPMLALLRDRPVHL
QRFPDGIEGEEIYQKRVPQKHPDYLETCVVTFPSGRTADALKITHPSSIIWAAQMGTVTL
HPWQVRCPDTEHPDELRVDLDPQPGTGFKEARTVACDVLKPLLDELGLVGYPKTSGGRGV
HVFLRIKPQWDFIEVRRAGIALAREVERRAPDAVTTSWWKEERGERLFIDYNQNARDRTF
ASAYSVRKTPIATVSMPLSWDELRNADPDDYTMNTVPDLLAGRDDPWADIDSVQQSLGPL
LDLVAADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEQGNRKQ

BLAST