GenomeNet

>msg:MSMEI_6136 DNA primase small subunit (EC:6.5.1.1); K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MASAATELDVDGVKVRFTNPDKVYFPKLGKNGTKGKLVEYYLSVASGPMLALLRDRPVHL
QRFPDGIEGEEIYQKRVPQKHPDYLETCVVTFPSGRTADALKITHPSSIIWAAQMGTVTL
HPWQVRCPDTEHPDELRVDLDPQPGTGFKEARTVACDVLKPLLDELGLVGYPKTSGGRGV
HVFLRIKPQWDFIEVRRAGIALAREVERRAPDAVTTSWWKEERGERLFIDYNQNARDRTF
ASAYSVRKTPIATVSMPLSWDELRNADPDDYTMNTVPDLLAGRDDPWADIDSVQQSLGPL
LDLVAADEERGLGDLPYPPNYPKMPGEPPRVQPSKKVAEHWDEQGNRKQ

BLAST