GenomeNet

>msl:Msil_1244 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MSGWITAVYRLRAGAAEVEARAEAIALEQSVEAPLAAVRDDFVRENIVGRVAAIEDCGGG
WFEARIELAAATIGYDAGQLLNMLFGNSSLLEDVLLVDAILPAPLAAAFGGPSHGLAALR
AEAGASGRALTCSALKPQGVPAAELAELAFALSMGGLDFLKDDHGLADQTYSRFEARIAA
CAAAVRKARDRTGGRTRYAPSLSGSYPQMRQQLLAARGEGLDAALIAPMIAGCSNFQALR
VEFPDFAFLAHPTMTGRAISPVLFARLFRLFGADVAIFPNYGGRFGYSPAVCEAIAAALL
SGDDGLKPSIPAPAGGMSVERTPELLDRYGRDVMLLIGGALLSAPREALTEQTRRFVEAV
ASHHYR

BLAST