GenomeNet

>msl:Msil_1736 DNA ligase D; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MADTKLKTYRAKRDFAQTAEPSGEAPIAAGPRRRFVIQKHAATRLHYDLRLELDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGVIPKGQYGGGTVQLWDRGFWAPEGDKTPE
QALADGDLKFTLDGQRLYGSWVLVRMKADRTGGKRTNWLLIKHRDGYARDGDADALLAED
RSVASGRAMAAIAAGKGKGPKPFMLAGEQAADPKAVWDSNKGLAAEARAAPKATRKKSGA
ALAQMPDFLPPQLCQPVERPPSGDGWVHEIKFDGYRMQLRVAGGKATLKTRKGLDWTDKF
AAIAAEAADFPDAIIDGEIVALDSSGSPDFVALQAALSEQNTDDLIFYAFDLMFEGGRDL
RLEPLAARKQALARLIAGARLGAGALIRFVEHFETGGDAILQSACRLNLEGIVSKKRDAP
YQPGRSDSWTRAKCRAGHEVVIGGWTTTEGKFRSLLAGVHHGENFTYIGRIGTGFGEAKV
KTLLPKLKQFAAETSPFTGPSAPRKTASIHWLKPELVAEIEFAGFTGAGMVRQAAFKGLR
EDKPAEEVEAETPAPPEQAAVPDPAEIQASARSSSDKPMATANGKPIVMGVAISNPAKEL
WPADGAEAPVSKLDLARYYEAAGPWLIEHVRGRPCSLIRAPDGITGQQFFQRHAMAGASN
LLDLVTVSGDRAPYLQIDRVEGLAAVAQIAGLELHPWNCAPGRPETPGRLIFDLDPGPDV
AFEQVAAAALEMRDRLDALGLVSFCKTTGGKGLHVVTPLAVAKGSKLTWPEAKGFAQEVC
RRMAADNSNAYLLNMSKKLRAGRIFLDYLRNDRMSTAVAPLSPRARPGATVSMPLNWSEA
TNSLDPKAFTIRTSVGLLDKSKAWADYDSGARPLEAAIKRLGRAKAAA

BLAST