GenomeNet

>msp:Mspyr1_55390 DNA polymerase LigD-like ligase domain-containing protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MTRASLAPDRLVAPAPMLATLGPAPRGGQFAVEVKFDGQRGILTVDRRVRVTSRNGADIT
ETFPELSAVAAAVGGRRMVLDGEIVAVDEHGRPSFRRLQRRWPQQRRPGAQLVREVPTRF
LAFDVMNIEGEDITHWPYRERRELLDTLMVMESSPALTVPRHWTDVAPADMLAICADQHH
EGIVCKRLDSPYRSGRSRDWIKVPVRATTEAVIVGAFAGPRGEVGALILAAHDEAGRLVL
LGQVGTGFSGAERRRLATLLAGTEAPAPPVAEGASMSGVQWFKPRYVGEVAYREYHAGKG
LRHASWKGLRTAPVSAVCLPRDTGAAPG

BLAST