GenomeNet

>msp:Mspyr1_55390 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) DNA polymerase LigD-like ligase domain-containing protein (A)
MTRASLAPDRLVAPAPMLATLGPAPRGGQFAVEVKFDGQRGILTVDRRVRVTSRNGADIT
ETFPELSAVAAAVGGRRMVLDGEIVAVDEHGRPSFRRLQRRWPQQRRPGAQLVREVPTRF
LAFDVMNIEGEDITHWPYRERRELLDTLMVMESSPALTVPRHWTDVAPADMLAICADQHH
EGIVCKRLDSPYRSGRSRDWIKVPVRATTEAVIVGAFAGPRGEVGALILAAHDEAGRLVL
LGQVGTGFSGAERRRLATLLAGTEAPAPPVAEGASMSGVQWFKPRYVGEVAYREYHAGKG
LRHASWKGLRTAPVSAVCLPRDTGAAPG

BLAST