GenomeNet

>msu:MS1182 K01775 alanine racemase [EC:5.1.1.1] | (GenBank) alr; Alr protein (A)
MKPATVKISSVALKHNIQIIKQKAPHSKIIAVVKANAYGHGVEFVSSTLENLVDGFGVAR
LAEALSVRSNGVTKPILLLEGFFSPKDLPILSVNNIQTVVHNQDQLDAIKRANLENPIKV
WLKIDTGMHRLGVSLEEVDYYYNELMNCPNVDEVGFVSHFSRADETDSDYTNIQLNRFLD
ATKNKKGNRTIAASGGILFWEDSHLEYIRPGIIMYGVSPINIPSSEYGLIPVMTLTSSLI
AVRDHKKGEPVGYGGIWVSERDTKIGVVAIGYGDGYPRNVPAGTPIYINGRRVPIVGRVS
MDMVTVDLGPDCKDKVGDEAVLWGKELPIEEVAEITGLLSYELMTKLTPRVLTEYVD

BLAST