GenomeNet

>msu:MS1617 K00799 glutathione S-transferase [EC:2.5.1.18] | (GenBank) gst; Gst protein (A)
MTALFYSFIMQPKFLINGNFMIILYALTQSRAYRIAWLLEILNLPYKLEIIERDGETNLA
PDALRSIHPLGKSPIIKDGDLVLTESGAIVEYLINRYGGGKLKPEMNSTDYWQYLHWMHY
AEGSLMPLLVIKLIFRKIDEADMPFIAKPIANKITEKVKQGFIQPQLKLHLDYIESQLAE
KFWLVGDELTGADIMMSFPLQAAVSYFETNQYPHISAYVSRLNHTESFKRAEQKLGPLTF
F

BLAST