GenomeNet

>msu:MS1617 gst; Gst protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MTALFYSFIMQPKFLINGNFMIILYALTQSRAYRIAWLLEILNLPYKLEIIERDGETNLA
PDALRSIHPLGKSPIIKDGDLVLTESGAIVEYLINRYGGGKLKPEMNSTDYWQYLHWMHY
AEGSLMPLLVIKLIFRKIDEADMPFIAKPIANKITEKVKQGFIQPQLKLHLDYIESQLAE
KFWLVGDELTGADIMMSFPLQAAVSYFETNQYPHISAYVSRLNHTESFKRAEQKLGPLTF
F

BLAST