GenomeNet

>msu:MS1995 K00113 glycerol-3-phosphate dehydrogenase subunit C [EC:1.1.5.3] | (GenBank) glpC; GlpC protein (A)
MNIQELIKQAKQDMQSPIAAEIFHDKSFESCIKCTACTAVCPVSRNNPLYPGPKQAGPDG
ERLRLKSPSFYDEALKYCLNCKRCEVACPSDVKIGDIIVRARNKHLAQQNKPFVQKLRDA
ILSNTDIMGTLATPFAPIVNTVTGLKATKFVLEKTIQVSKHRTLPKYSFGTFRSWYMKNA
AKEQAKFDQKVAYYHGCYVNYNNPQLGKEFIQVFNAMDIGVVLLEKEKCCGLPLSVNAFP
ERAKKLAQFNTDYIEKMLDENGLDVISEASSCTLNLRDEYHHILGIDNAKVRPHIHMVTP
FLYKLFQQGKTLPLKPLKLRVAYHTACHVEKAGWAPYTLEILKQIPGLEVVVLPSQCCGI
AGTYGFKAENYETSQAIGKTLFDNINEGGFDYVISECQTCKWQIDMSSNVTCIHPITLLA
MSINQ

BLAST