GenomeNet

>msu:MS2071 K01176 alpha-amylase [EC:3.2.1.1] | (GenBank) amyA; AmyA protein (A)
MKKSLLYLCLFTSSAAFAQGWQHTHFQHFNDNAESNLFQSQTPLGKGNYPLTFTLDNQCY
QPQSAVKLNQTVSLIPCSGEAPQLRLFRQGNYIAQIDMRSGTPTLRISVEQRAENDNNTV
KSCPVWNKQPIEIDVSSTFTEGESVRDFYSGQTAKVKNGKVTMMPAENAGGLILLEKSAD
KKTEVFDWKNATVYFVLTDRFHNGNPANDNSYGRHKDGMQEIGTFHGGDLQGLTAKLDYL
QQLGVNVLWISSPLEQMHGWVGGGNKGDFPHYGYHGYYHLDWTKLDANMGTEADLKNLMR
QAHRRGIRVLFDVVMNHTGYATLADMQEFNFGDFYLKPEEMAATLGKKWTTWQPQKGQNW
HSFNDFIKFGDSKAWQNWWGKDWVRADIGDYDSPKFDDLKMSLSALPDLKTESESAVKLP
RFFQHKNTNAKELANAKVRDYLITWLTDWVRRYGVDGFRVDTAKHVEKPTWLALKQASQQ
ALKEWQQKNPQESFGDDFWMTGEAWGHGVFKSDYYQNGFDAMINFDFQDQAKNALDCFAR
IDPVYQDMSNKLKDFNVLSYLSSHDTRLFFHSDSERNAVKQKTAANLLLLSSGAVQIYYG
DESGREFGATGSDPVQGTRSDMNWKELQNDQSKQALHQHWQKLAQFRQRHRAVGAGVHQT
LKSEGYFAFSRTLGEDKVMVVWAGN

BLAST