GenomeNet

>msv:Mesil_0322 ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MEWFKAVYHLESTPADIEARARALAIEQSIEMPPSAVRQAEILQDILARVEEIEPAEPGY
FRVVLQMAVATTAFDTSGLLNMLFGNCSLQEDVELIDMELPPNLLEAFSGPRYGIAGLRH
LLNAYDRPLTCTALKPQGLSPEQLSDLAYTFALGGLDIVKDDHGITNQVYSPFHQRVPAI
QKAIQRANLETGGHTLYAPMLAGSPRVLRENLRVARDEGIRVVLVAPMLIGLPVFEELMG
GSGMAVLAHPAFAGNRIAPPLFFGKLFRLLGADAVIYPNHGGRFSYSRDTCMSLAQAARA
PWGHVLPALPVPAGGMTVERVDEMVGFYGPDTMLLIGGNLLAAGDGVLERTRAFVRRVAA
SVV

BLAST