GenomeNet

>msv:Mesil_3254 hypothetical protein; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRIHQGTFSFLPDLTDEEIERQIAYIRQNGWAVSIEYTDDPHPYNTFWHMWGLPMFDLED
AAGAMYEFKKCREAFPKHYIKINGFDPSPMWQAQRVSFIAHRPTSDEPGFRLRRILWSDG
RVQKYGLEPYVEDQPAGERY

BLAST