GenomeNet

>msy:MS53_0521 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) tdk; thymidine kinase (A)
MRWKYDIGSLEVITGPMFAGKSNEIIRILNVNQIAGFKPLSFKPDFDTRWSVNHIVSRTG
SKMETINLKDPKDIWNHIKKDTQVIAFDEVHFFDMSIVAEIQKLIEKKYKVIVSGLDMDY
LGKPFEVVSQLCCLADKIKKLKAVCMNCHGVANMTYRKVDNNERNLLGDSEYEARCRNCH
KLR

BLAST