GenomeNet

>mta:Moth_2067 no KO assigned | (RefSeq) hypothetical protein (A)
MDREMTTGQQVNGEPYMLPRLPGQQLRLTNLDKVFWPEGLTKFDLVEYYVDMAPGILPYL
RERPLVLKRYPDGITGEAFYQKECPAYAPEWVATLPVYHTDSDKTINYVLCNNEATLAWL
ANQGCIEVHAWLSRAGRLEYPDIVVMDLDPADGTTLVDVLEIALLVNRALKELHLTGYPK
NSGARGLHIFIPLYPRWTFREVTAAMGYLAHLIVQVYPRKATTEHLIHRRRGKVYLDYLQ
NVQGRSMTFPYSLRPLPGAPVSAPLTWEEVAAKKIYPGDFNIIRRRLEEWGDLYRELLER
PNDLTPLLELAI

BLAST