GenomeNet

>mta:Moth_2067 hypothetical protein (A)
MDREMTTGQQVNGEPYMLPRLPGQQLRLTNLDKVFWPEGLTKFDLVEYYVDMAPGILPYL
RERPLVLKRYPDGITGEAFYQKECPAYAPEWVATLPVYHTDSDKTINYVLCNNEATLAWL
ANQGCIEVHAWLSRAGRLEYPDIVVMDLDPADGTTLVDVLEIALLVNRALKELHLTGYPK
NSGARGLHIFIPLYPRWTFREVTAAMGYLAHLIVQVYPRKATTEHLIHRRRGKVYLDYLQ
NVQGRSMTFPYSLRPLPGAPVSAPLTWEEVAAKKIYPGDFNIIRRRLEEWGDLYRELLER
PNDLTPLLELAI

BLAST