GenomeNet

>mtd:UDA_3032 K16150 glycogen synthase [EC:2.4.1.11] | (GenBank) unnamed protein product (A)
MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPSTHPSSDEVTEG
VRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKLGTDRSWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSASMND
EITELFGPGLAEITVIRNGIDAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPR
LRRTHPGTTLTIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAAAVRSVLDDPA
AAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQPQPRLPIVEHALPDR

BLAST