GenomeNet

>mtd:UDA_3062 ligB; hypothetical protein; K01971 DNA ligase (ATP) [EC:6.5.1.1] (A)
MLLHDVAITSMDVAATSSRLTKVARIAALLHRAAPDTQLVTIIVSWLSGELPQRHIGVGW
AALRSLPPPAPQPALTVTGVDATLSKIGTLSGKGSQAQRAALVAELFSAATEAEQTFLLR
LLGGELRQGAKGGIMADAVAQAAGLPAATVQRAAMLGGDLAAAAAAGLSGAALDTFTLRV
GRPIGPMLAQTATSVHDALERHGGTTIFEAKLDGARVQIHRANDQVRIYTRSLDDVTARL
PEVVEATLALPVRDLVADGEAIALCPDNRPQRFQVTASRFGRSVDVAAARATQPLSVFFF
DILHRDGTDLLEAPTTERLAALDALVPARHRVDRLITSDPTDAANFLDATLAAGHEGVMA
KAPAARYLAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRRGKLSNIHLGARDPATGGFVM
VGKTFKGMTDAMLDWQTTRFHEIAVGPTDGYVVQLRPEQVVEVALDGVQRSSRYPGGLAL
RFARVVRYRADKDPAEADTIDAVRALY

BLAST