GenomeNet

>mte:CCDC5079_3462 hypothetical protein (A)
MCSFLRAACWNSDMAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGG
PMLTALRDRPTHLQRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPA
AIVWAAQMGTITLHPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLG
LVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARI
FIDFNQNARDRTMASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPW
AGMDDVAQSIAPLLDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK

BLAST