GenomeNet

>mtg:MRGA327_22985 no KO assigned | (GenBank) hypothetical protein (A)
MYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHLQRFPDGVDGEQIYQKRIPRHRP
DYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITLHPWQVRCPDTEHPDELRIDLDP
QPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIAL
AREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTMASAYSVRPTPIATVSMPLTWEE
LAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPLLDLAAADEERGLGDMPYPPNYP
KMPGEPKRVQPSRDTDLKGGNTSK

BLAST