GenomeNet

>mth:MTH701 acetyl-CoA synthetase-like protein; K01895 acetyl-CoA synthetase [EC:6.2.1.1] (A)
MTALINEFVNRVEFDSYEDFRDNFRINVPENFNFAYDVVDRYAEIEPDKVALVWCNDHGE
EKRITFGELRDLSSRAANFFTKEGIQKGDTVMLTLKARYDFWYALLGLHRIGAIAIPATH
MLKEKDIVYRIREADIKMVVCIAEDGVPEVFEGAIAELGSDTRRVLVGDTDRDGWINLRK
EIMKLPADFERPEACAGGDDTLIVYFSSGTTGMPKMIEHDHTYPLGHIITAKYWQNVRED
GLHYTVADTGWAKAMWGQIYGQWIAGSAVFVYDYDRFDPEKMLEKLEKYEITTFCAPPTI
YRFLIKEDLSRYDLSGIEYAVTAGEPLNPEVFERFREHTGLQLMEGFGQTECVVCIANFP
WMEPKPGSMGKPSPGYPVELVDRNGDPVDVGEEGEIVIRTAEGKPLGLFNGYYRNPEKTS
EVWHD

BLAST