GenomeNet

>mti:MRGA423_23530 hypothetical protein (A)
MASIGDTGGMTGNCMCSFLRAACWNSDMAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGT
KRRLVEYYFAVAGGPMLTALRDRPTHLQRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFP
SGRMADALKVTHPAAIVWAAQMGTITLHPWQVRCPDTEHPDELRIDLDPQPGTGFVEART
VAVDVLRSVLDDLGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIALAREVERRAPDA
VTTSWWKEERGARIFIDFNQNARDRTMASAYSVRPTPIATVSMPLTWEELAGADPDDYTM
TTVPELVKIRDDPWAGMDDVAQSIAPLLDLAARPTRSAGSVTCRIRRATIRRCRANPSGC
SRAGIPT

BLAST