GenomeNet

>mti:MRGA423_23530 no KO assigned | (GenBank) hypothetical protein (A)
MASIGDTGGMTGNCMCSFLRAACWNSDMAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGT
KRRLVEYYFAVAGGPMLTALRDRPTHLQRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFP
SGRMADALKVTHPAAIVWAAQMGTITLHPWQVRCPDTEHPDELRIDLDPQPGTGFVEART
VAVDVLRSVLDDLGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIALAREVERRAPDA
VTTSWWKEERGARIFIDFNQNARDRTMASAYSVRPTPIATVSMPLTWEELAGADPDDYTM
TTVPELVKIRDDPWAGMDDVAQSIAPLLDLAARPTRSAGSVTCRIRRATIRRCRANPSGC
SRAGIPT

BLAST