GenomeNet

>mtm:MYCTH_116363 K01113 alkaline phosphatase D [EC:3.1.3.1] | (RefSeq) alkaline phosphatase-like protein (A)
MHILSTLSLAALSAPLASASFDGNINYLSPSRRHVNLGIDVPAVARRSMKRGAVPYKPSE
LNFTHGIASGDPYPDSVILWTRVAPSLASDNSNVTVEGTVDLYNHETEKYVKADPNPICV
EWKVWEAQEKGSKRPGHGGSGKHIVSQGTAYTTSDIDYTVKVEAKGLKPFTTYNYQFNVC
KSDNASPVGRTKTAPRENAKLDEINLAVFSCSNFPNGYFNAYGNAARKDKHDYVVHLGDY
IYEGAQGGERAHNPPRIIFSLWDYRTRHGQYRTDPDLQLLSQNYAWMPTWDDHEIANNGY
RDGFSALNNTEDSFRKDGPSISVDQRKMNAVRAYFEWMPIRQVDLDDNLRIWRSFKLGRL
LDLIILDTRNYDRSITSLGWNDHYIDLIRDDASRSLMGSRQEHWFYNQLAESSRRGAAWR
VVGSQVIFSDINNSGDTWSGYTANRNRTLKHLYDNKIGNNVFLAGDSHQNWVSDLAWLGE
KPYDSQTGEGAVGVEFAGTAVSSSGQSGPILAAREKARQQVEANELMQWQEGYYRGYFIL
RIREEAVTAQYFGSPSVATPNAWDLPLANFTIASGKNHLTRPVAGGNVEAGFVRGGTTTG
TNLTLNTETGKWDVVGFEKMYIK

BLAST