GenomeNet

>mtm:MYCTH_2094824 hypothetical protein (A)
MARIHNRGKANGAVGVDSINANSTASVDKAEKLASKAKPKPVPLKLKPTKADRKGVANAF
ERHAQVIHAKVEPPASQAGAGTAPRRWGKLSTVLKTLRSNAPDWKTLKTMILKKVKGELL
TDDKTMLMEHIIQLVSNLPSDSKLRVELTNNFLSELWSSLEHPPPRYLSDKYKYRQADGS
YNNIMFPQLGAAGSVYARSVNASVLRPGALPDPNLIYDSVMKRTEYKKHPNNVSSILWYW
ASIIIHDLFWTDHKDMNRSKTSSYLDLSPLYGSNQEMQDTIRTFKDGKLKPDCFADKRLL
GMPPGVGVLLIMFNRVHNYVCDNLIAINEDGKFTPASPNLTGEEAATAWKRYDNDLFQTA
RLITSGLYINITLLDYVRNIVNDDKWIEEFYYDLFGKPGSEVTVQDLIMGFAKFESRLPE
DPLERPFNGFKRGPDGKFDDDDLVECITSAIEDCAGSFGARNVPASMRAIEILGIIQGRK
WNVAGLNEFRRHFGLKPYETFEDINSDPGVAEALRRLYDHPDFVELYPGLVAEEHKQPMV
PGVGIAPTYTISRVVLSDAVCLVRGDRHYTVDYNARNLTNWGYNDVQYDLSINHGCVFYK
LFIRAFPHHFKYNSVYAHYPMVVPAETQKILKDLKRDHLFDFSRPTRIAQDVECTSVEAA
RRVFASPDKYKPSWHASVDALAPEGKSKLSADAAIHDRHRREVSQPLATADFVSQVKAFY
ATVTEQLLDSQSYHLGGLKLADLVRDIGNIAPTRFVSALFNLPLQTEDNPKGIYREHELY
VVLSVIAEAVFTNPDPVKKFPLFEAAKTVAAQLASAVERTVKNPKAKKKDPLSTYGARLI
KGLSKAGLNTHDITWGHVLTSSAAIAPYQAKLFAEAVDFYLSPRGAPYLEAVRSLAAQPA
SEQADSLLLGYALEAVRLSGSTKLHFEATAADSLPAEDGTQIQVQPGDRIAVTSSAASDS
EVDPSRPRESYVHLAGLPNSSFLGTREIGYAALTAMFRALFRRPNLRRAPGPQGELRRVV
GVDGASPGAVEYLREDWGVKGPWPVTMKVCWDENV

BLAST