GenomeNet

>mtm:MYCTH_2295756 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MAVGTLADAPKDLISEIKHLEELFTVDTAKLKEITNHFVNELAKGLSVEGGSIPMNPTWV
MSQPTGYETGSYLALDMGGTNLRVCQVTLTEQKSEFDIIQSKYRMPEELKTGDAEELWEY
IADCLQQFIETHHGDVSKLEKIPLGFTFSYPATQNYIDEGILQRWTKGFDIAGVEGRNVV
PMFEAALARRGVPIKLTALINDTTGTLVASAYTDPKMKIGCIFGTGCNAAYFEDFGSIPK
LAHVDIAPDTPMAINCEWGAFDNEHVVLPRTPYDVAIDRDSPRPGQQAFEKMIAGLYLGE
IFRLVMVDLHDKKDVNIFAGQDVSKLRKPYTLDSSFLSAIEEDPFENLSETLELFQNKLN
ISPSLPELELIRRTAELIGTRAARLSACGVAAISIKKGYKTCHVGADGSVFNKYPHFKAR
GAQALREILDWPEKKDPKEEDPIEILAAEDGSGVGAALIAALTLQRVKAGIMHGILNKEN
FV

BLAST