GenomeNet

>mtm:MYCTH_2297816 K04565 superoxide dismutase, Cu-Zn family [EC:1.15.1.1] | (RefSeq) hypothetical protein (A)
MVKAVAVVRGDSKVTGTVVFEQESESAPTKITWDISGHDPNAKRGFHIHTFGDNTNGCTS
AGPHFNPHGKNHGAPTDENRHVGDLGNIETDAQGNSKGSVTDSLIKLIGPESVIGRTVVV
HAGTDDLGKGGNEESLKTGNAGPRPACGVIGISQ

BLAST