GenomeNet

>mtm:MYCTH_2305783 glycoside hydrolase family 13 protein; K01176 alpha-amylase [EC:3.2.1.1] (A)
MRTSIISTAVATALAFAGLGSAANITEWKSRSIYQVMIDRFARTDGSTDASCDVSRFCGG
TWKGLLNNLDYIQDMGFTAIQISPIVKNIEEHTSVGDAYHGYWSVDNYALNDRFGTKQDF
EDLVAELHKRDMLLMVDVVVNNMAQAFDNVVPPKIDYSKFNPFNDKKYFHPYCNVTQWEN
ATDYQNCWLYPYGVALADLATETKPVSDELGRWVKELVANYSIDGIRIDAAKHVNDGFLP
GFVEASGVFAFGEVLTGLPEDMCRYQSLGLLPGMPNYLEYYQLNEAFNGGSMADVAEMRN
EAASSCNDTAALGSFLENHDMPRFANRNDDMALAKNGMTYILLNDGIPTVYQGQEQHFKG
NGTPFNREPLWSSEYNKESPLYVLTATLNKVRNNAIKLSSDYISTPSETLWADVNHLCLR
KGPDGSQVVFCINNKSSQGESYQISVGGFQKNEKVVEVLTCKTNTADISGNVTMYMNKGE
PKVYVPQAALSGTGLCDKTEEDGPSSGAAALGLTGSVVLTAVIGWAVVLLA

BLAST