GenomeNet

>mtm:MYCTH_2306437 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MASNSGRRLNIDNINPHVRAAKYAVRGELAVKSEEYRAALQNGATDLPFKQVISANIGNP
QQLDQKPITFIRQVLSILENPALLEKGDVLVNHLGYKPDVLERAKKLLAAVGSVGAYSPS
NGAPAIRQSIAEFLERRDGFPANPADIYMSAGASSGVNTLLHIICADEKSGVLVPIPQYP
LYTASLSVLNATCVPYYLDEQKNWGTDLATIRAAHEKAKAEGVDVRAIVIINPGNPTGAS
LPEEDIRAVIEFARQERLVILADEVYQTNVFIGEFISFKRMLRQMQKEQPGTYDNIELAS
LHSVSKGMIGECGHRGGYFELVGFDPLVQAEIYKFVSIMLCAPVIGQCLVELMVNPPKPG
EPSYDLYIQEYNAIFNGLHERATALHKAFEQMEGVECGVPQGSMYLFPTIKLPPKAAKAA
AAEGRTPDEFYCLRMLEATGVCVVPGSGFGQKEGTLHFRTTFLAPGTEWVGSIVKFHKEF
MDKYR

BLAST