GenomeNet

>mtm:MYCTH_2306764 glycoside hydrolase family 33 protein; K01186 sialidase-1 [EC:3.2.1.18] (A)
MRWLQGIALWAALAPLSHANVPDPAKDATPYHEEFVLFRSANMASPDKLSSGVGFHSFRI
PAVVRTNTGRILAFAEGRRHNNRDYGDINLVYKRTKTTTSHGASFSDWEPLKEVVGAGAG
TWGNPTPVVDGDTIYLFMSWNGAQYSQNGGDTLPDGSKTKKIDSTWEGRRHLYLSKSTDD
GATWSEPEDLTETLTPAGRAWDAVGPGIGIRLTTGELVVPAQQRNIIGRGPPGNRTWSVQ
SLPGAGSEGTIAQTPDGQLYRNDRPGSNSDYRRVARGNLTSFGAFADDTGLPDPGCEGSV
LLYNLADDKGPARVVFMNSASKDSRRAMRVRISYDSDAAKFNFGRELGDAPVSGAGYEGG
YSSMTKTADYKIGALVESDFYNDKGGEKSYRAIIWRRFNLSWILNGPRN

BLAST