GenomeNet

>mtm:MYCTH_2306764 K01186 sialidase-1 [EC:3.2.1.18] | (RefSeq) glycoside hydrolase family 33 protein (A)
MRWLQGIALWAALAPLSHANVPDPAKDATPYHEEFVLFRSANMASPDKLSSGVGFHSFRI
PAVVRTNTGRILAFAEGRRHNNRDYGDINLVYKRTKTTTSHGASFSDWEPLKEVVGAGAG
TWGNPTPVVDGDTIYLFMSWNGAQYSQNGGDTLPDGSKTKKIDSTWEGRRHLYLSKSTDD
GATWSEPEDLTETLTPAGRAWDAVGPGIGIRLTTGELVVPAQQRNIIGRGPPGNRTWSVQ
SLPGAGSEGTIAQTPDGQLYRNDRPGSNSDYRRVARGNLTSFGAFADDTGLPDPGCEGSV
LLYNLADDKGPARVVFMNSASKDSRRAMRVRISYDSDAAKFNFGRELGDAPVSGAGYEGG
YSSMTKTADYKIGALVESDFYNDKGGEKSYRAIIWRRFNLSWILNGPRN

BLAST