GenomeNet

>mtm:MYCTH_2308202 hypothetical protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MLIALSRAFLLSKPPGAEFATKDPKALAKLKKEELAEIWARSEELVKASYARHPDYNDLI
PVLLEIGISEELLVRCGLTLHIPLRPMLGNITRDLSEMLTKLQGRDFTCEYKYDGQRAQV
HCDSNGKVSIFSRHLELMTDKYPDLVALVPKIRGEGVESFILEGEVVAVDRATGELKNFQ
TLTNRARKDVAIGAITIDVCLFAFDLMYLNGQPLLDQPFRHRRDLLRSLFVEIPHHFTWV
RSLDATSQDSESVLEFFKSALDSKCEGIMVKTLDNLPDLEYCGDKEGPEQTGPELNSSFT
AKNSGSKSKRRDNGGSSNNNNNNNNNGPPKSRRKPLLATYEPDKRLDSWLKVKKDYSSSS
DTLDLIPIAAWHGQGRKAKWWSPILLAVRNEETGCLEAVCKCMSGFTDAFYKANREFYDD
GDEDSGVGRGRRNTHARKPGFVEYAGGVPDVWFEPCEVWEVAFADITVSPTYTAAIGLAK
EDRGLSLRFPRFLRKREDKGIEEASTSAYLAALWRKQEARAPQAAETAGQAAEEDELDDE
EAAAAEE

BLAST