GenomeNet

>mtm:MYCTH_62332 histone deacetylase phd1-like protein; K11483 histone deacetylase HOS2 [EC:3.5.1.98] (A)
MDVSAYQYRPPKPNYLPHNIEADDPIVEEYAVPLGKADDRENAIFFNKMKFAAQEYGIVR
PKGYRVSYHATPEMEKHHFGQTHPMKPWRLTLTKSLVTSYGMPFAMDNYVTREATYEELN
AFHSSDYLDYLSTATPEDQPQDIDNSDKEVKYNLGGSDCPLFHGLYNYCSMSAGCSLDAA
RKITNNQSDIAIAWGGGLHHAKKYEASGFCYINDIVLAILQLLRIYPRVLYIDIDVHHGD
GVEEAFYSTDRVMTVSFHKYHPETFFPGTGALEDNGPKSEHNPGAHHAINVPLQDGITDE
QYENLFQSIIGPINERYRPSAIALQCGADSLAGDRLGRFNLRVQGHGACVRYCKSLGLPM
IMFGGGGYTPRNVARAWAYETSIAIGADTRIPETIPEHAPWREHFIHDTLFPTLEQSMNE
PRHNRNSDKRLREIVAHVHEQLRFVSHAPSVQSTIIPPDLGPIRDDVEARLKEESEEKDG
GLRKIQEEGLGQEGEF

BLAST