GenomeNet

>mtm:MYCTH_73315 hypothetical protein; K11429 histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43] (A)
MPRIATATSKKQSLTFAQLAAYDDILTDALIDRVYYWTTIPKNRPSYHPSRGVREEEIAK
IIQTHLIVEPNLAVAEEKLLSTDGLRKFHDSLKTAKEREDFRSHLRRYMSIYLPDCPFEV
NATNRYTIESYEASITARRPIRRNEAIKYLAGIQVTVTPEEEAQLALRKKDFSLVVSSRS
KLTSLFMGPARFANHDCSANARLVTGGQAGIQIFACRDIAVGEEITVTYSESYFGENNCE
CLCQTCEEKGVNGWRPEDGVLSVHRSIEDSPFDVDQGYSLRSRKRDRSLSVAGSRTSSVT
PDIRPRIPKGSRRRSMVGDRASTTDSLDGENLAMSNASLKRKLDTAGLSSPPLTPSKRSQ
PDRYSTAPASSSISRGSSAVGSAGDSVVSEDGKSALTEVTSPEPDKPGPLLSPELSPVKQ
SDAPIGQLVGGRLPHLPLTSAETLKSTSILPTTESDPMQGPVGNASTTASSPPDPESTPA
NDPNDEAATVTSASATRRRKRGISNQPAADRPRRRRVPGDYTLTPLLLSEPETAWIHCTN
CNTAFVQKDAYFTKANCYRCERHSKLYGYVWPKTAPEGKHDKEARVLDHREINRFLHPED
EAIIRGRKPWRERLTGASAEPTSGEERGQESLRREPDRSKPRASSDLEAPARRSGRIRRA
SARALGE

BLAST