GenomeNet

>mtp:Mthe_0757 phosphoglycerate mutase 1 family protein (EC:5.4.2.1); K01834 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] (A)
MYKLVLLRHGQSSYNAERRFTGWSDPDLTAQGMIEAREAGRILRRSGYTLDIAFVSMLRR
AIKTLCGVLDEMDLLWIPVRKSWMLNERHYGELEGQIIDDVPDELKMYRHSFDIRPPALS
EDDPRHPRFDRRYSDLESPPAGESIRDVQERLLILWTYEIAPEILSGRGVIVTTHANVIR
AFMNYLEGVPTEGLMVPRGRPIVYELGEDLKPIRRYCL

BLAST