GenomeNet

>mtp:Mthe_1333 hypothetical protein; K01622 fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11] (A)
MSKVTVSLIKADVGGWPGHASVHPALIDKAEEVLSEAKSAGTLIDFKVMACGDDLELLMT
HRLGTDEAEIHAIAWETFEKATAEAKSLKLYGAGQDLLCDAFSGNIRGMGPGVAEMQFTE
RDAEPLVAFMMDKTEPGAFNLPIFRMFADPFNTAGLVIDPSLHNGFIFEIWDILDHKKVF
MSCPEEMYNILALIGAKSRYVIKRVYPKPGGKLPSEEPVAVVSTEKLYQTAGTYVGKDDP
VALVRAQSGLPALGEVLEPFALGHLVSGWMRGSHNGPLMPCAFEDAHPTRFDGPPRVIAA
GFQLCNGLLIGPVDLFADVAFDLTRMRVLEITDYMRAHGPFEPHRLPLEDMEYTTLPHVL
KRLAERFEPAE

BLAST