GenomeNet

>mtr:MTR_3g083230 thymidine kinase-like protein; K00857 thymidine kinase [EC:2.7.1.21] (A)
MASSLGVGSSHSHSSSGEIHLFVGPMFAGKTTSLLRRIKSEVDNGRNVAMLKSSKDNRYA
VDSVVTHDGIKFPCWALPDLMLFKDKYGHEAYQKLDVIGIDEAQFFEDLYDFCCKAADED
GKIVVVAGLDGDYMRRSFGSVLHIIPIADTVTKLTARCELCGKRAFFTLRKTGEKQTELI
GGADLYMPVCRHHYVNGQVVVEAAMKSVFGSQKVGCGSLIETAPVV

BLAST