GenomeNet

>mtr:MTR_4g010550 histone-lysine N-methyltransferase, suvh protein; K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] (A)
MRMTQWKPKQNQKSNVKEVKRFDLQAAKKLKEEGSHVNEGENILGSVPGVEVGDEFQFRI
ELNIIGLHRQIQGGIDYVRQKDKILATSIVASGGYADDLDNSDLLIYTGQGGNVTSSDKE
PEDQKLERGNLALKNSNEEKNSVRVIRGYESMDGKRKIYVYDGLYVVESCWQDIGPRGKM
VYKFSLRRIPGQPELRRSMCRRYFLREREIPICAVNTIDNEKPPTFKYITEMIYPECCNL
VPPKGCNCTNGCSDHKKCSCVVKNGGEIPFNHNGDIVEVKPLVYECGPKCKCPSTCHNRV
SQLGINIQLEIFKNLNSMGWGVRSLNSIPSGSFICEYIGEYLFDIGNNKNNNNLWDGLSN
LFPDSSSSEVVEDSDFTTDAAQFGNVGRFVNHSCSPNLYAQNVLYDHQDSRVPHIMLFAA
ENIPPLQELTYDYNYTIDTVRDSDGNIKKKYCFCGSVECTGRLY

BLAST