GenomeNet

>mtr:MTR_5g037380 glutathione S-transferase, amino-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MATNDLKLLGGWFSPFAVRAQIALSIKGLDYENIVENLNSKSDLFLQSNPVYKKIPVLIH
GDKAICESAIIVEYIDEVWKNNGTPSILPSNAYDRASARFWGAYIDDKLYNSLRNGLFAQ
DIESKKKHFEELAEVLLKLEDVLNKSSGGKDFFGGEKIGFVDIAFGCYLSWLRVKEKFTG
EKAFDEAKTPSLVKWAEAFATDPAVKGILPETDKLVEYALAMAAAIPK

BLAST