GenomeNet

>mtr:MTR_6g005470 Isocitrate dehydrogenase-like protein; K00031 isocitrate dehydrogenase [EC:1.1.1.42] (A)
MLRASSSSSLFRLTSTLTMLSSSCSLRNPNNLLFHSTPSSSLFLPHPPNSLSFHNHNHNP
FIPLRCFASSTPIHVANPIVEMDGDEMTRIIWKMIKDKLIFPYLDLNIKYFDLGVLNRDA
TEDRVTVESAEATLKYNVAVKCATITPDETRVKEFGLKSMWRSPNGTIRNILNGTVFREP
IICRNIPRIIPGWKKPICIGRHAFGDQYRATDTVINGPGKLKLVFVPEDGDTPVELDVHD
FKGPGVALAMYNVDESIRAFAESSMSLAFTKKWPLYLSTKNTILKKYDGRFKDIFQEVYE
ERWRQKFEEHSIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDLLAQGFGSLGLMT
SVLLSSDGKTLEAEAAHGTVTRHFRFHQKGQETSTNSIASIFAWTRGLEHRAKLDKNEKL
LDFADKLEAACVETVESGKMTKDLALLIHGPKVSREFYLNTEEFIDAVASNLERKLREPA
TV

BLAST