GenomeNet

>mtr:MTR_7g052480 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) SET-domain protein lysine methyltransferase family protein, putative (A)
MEVTKSCENEAMMMVPTRASSRLQNLSKIQYNIYNSSGDKVFGQHVEKTELESSKESLAT
ITKVRSQHQNRNKIPDDISHKRGMVSFEDNAEKTELGSKEESLVSTTKVCSQLQNRNEIP
DDISHKRGMVSLEDNVVEKRTKINSLRRKPCSRSRSTSNDSLVFDGLDFRGILSLRETSR
LANLRCLAKQEEKNQSKNRHKKGKNIATLLRASNVEKNGIDNEYVPGITTSKYLINKLRE
LAKVGTYKVHLMEGQVSKALSSSPSLVCKDISNGQEAISIIATNDFDDPPVAPTGFEYIT
SNKVSPSIEVPSNAAGCNCKGSCRTKRCSCANHNGSEFSYNNIGRLIEPLDIVVECGPQC
GCGPKCGNKISQQGLSYRLEVYRTAKKGWAVRTWDFIPSGAPVVEYIGVLSRDDELGSAN
GNDYIFDIDCLHTINSVDGRERRLGNVPLPINNLSEKKDELMEKDPEYCIDAGSFGNVSR
FINHGCEPNLFVQCVLSCHRDPRLARVVLFAAEDIPPYQELTYDYGYTLDSVSGSDGKIK
QLQCHCGAKECRKRLY

BLAST