GenomeNet

>mtr:MTR_7g065660 glutathione S-transferase, amino-terminal domain protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MATNQEHVNLLGATGSPFVCRVQIALKLKGIEYEFVEENLATKSEQLLKYNPVHKKVPVF
VHNEKPISESLVILEYIDEVWKQNPILPSDPHQRALARFWSKFIDDKIVSTSFKSVFSLD
EKEREKNIEEATEALHFLENELKDKYFGGEEFNFVDIAAVFVAFWVPLVQDITELQLFTA
EKFPKLYNWSQEFLDHPVVKETLPPREPLFAFFKGRYESLLAASK

BLAST