GenomeNet

>mtr:MTR_7g100320 IN2-1-like protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MATTVKEIRTPPLTSNSDPPPIFNGDTRLYISYVCPYAQRAWIARNYKGLQDKIKLVSIN
LQDRPAWYKEKVYPENKVPSLEHNGKVLGESLDLISYIDVNFEGLSLVPSDPAKKEFGDQ
LISHVDTFTKDLYSSLKGDPIKQAGPAFDYLENALGKFDDGPFFLGQFSWVDIAYVPFVE
RFHIVFSEVFKHDITEGRPKLAAWIEVQLKQLSLKLQFSIIAFIYELITNQGHQSKLEEN
FICSEN

BLAST