GenomeNet

>mtr:MTR_8g061950 K00799 glutathione S-transferase [EC:2.5.1.18] | (RefSeq) glutathione S-transferase, amino-terminal domain protein (A)
MAKSDVKLIGKWSSPYVTRVKIALNIKSLEYENFEENETFNPKSDILLQSNPVYGKVPVL
IHKDKPISESLIIVEYIDETWSSAPSILPSDTYDRAVARFWAAYIDQKWFPPMQSIITVE
GEDERKPYFEVLEEVVERMEEAFEKCSKGKPFFGGDRIGYLDIAFGSFLGWLSVIEHEYE
RKVLVEEKAPNLVKWAERFASDPAVKGLIPETERLVKLSKALQIKWRAAICKK

BLAST