GenomeNet

>mts:MTES_3162 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MVEQTVQIGGRRLRLSNLDKVLYPETGTTKGEVIDYYSRVAARLLPHVADRPVTRKRWPD
GVGTADAPGEPFFAKALEPGAPAWVRRFPIDHSSGAKDYPLVDDLPTLVSLAQVASLELH
VPQWRFSPDGERQNPDRLVLDLDPGPGVGLVECAEVARWARAILRDIGLDPLPVTSGSKG
IHLYAHLDGKQSSEAASAIAKELARAIEADHPDLVVSQMSKAARPGKVFIDWSQNNGSKT
TIAPYSLRGRAQPTVAAPRTWEELDDPALRHLLFTDVLERTGDPLAAVERETGPLRAYIS
KRTAGRTPEPVPEAPHGEPAPEGLPRFVIQEHHASRLHWDLRLEHGGVLVSWAVPKGIPS
TTAKNSLAVMTEDHPMQYLDFTGEIPRGEYGAGIMTVWDTGTYELEKWRDDEVIATLQGR
DDGPLGRVRVALIRTEGRGEKSQWLLHRMKTDAEGRPQADGAPVVALDHGRVGRDPEPRG
AAAGHADGDVDAPDGSRRGAPSPADVRPMLATSATPGLARAAAGRWGQAWVEMKWDGIRG
IGLWDGRRLRLRSRNGNDLTAAYPELTTVDLGLGPEPAIIDGEIVALDPQGRPSFPLLQK
RMNLAQPREIEREARRTPVHLYLFDVLSVGDRDVSPLPLAERRGILESLAQKATAPVVIP
PVFDDVDAAVATSGRFGLEGVVVKDPRSPYRRGERSEQWLKVKHSRTQEVVVGGVRPGKG
NRAGTIGSLLVGVPDPDGLRYAGRVGSGFSEQTLARLSELLAPLGSDADPFVGVPAADAR
DAIWVRPELVAEVEFAEFTPDGILRQARWRGLRPDKDPSEVVREG

BLAST